PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 908aa    MW: 100619 Da    PI: 5.546
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695960PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-36909PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.28.7e-09226267346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE+ ++++   ++G++ +k+Ia+ +  +Rt  +c+++++k
        Lsa009812 226 AWTEEEQGIFLEKYSLFGKD-FKKIASFLK-NRTCGDCVEFYYK 267
                      7*****************99.********9.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-14209270IPR009057Homeodomain-like
PROSITE profilePS5129315.138222273IPR017884SANT domain
SMARTSM007173.7E-9223271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-6226267IPR009057Homeodomain-like
PfamPF002498.2E-7226267IPR001005SANT/Myb domain
SuperFamilySSF466892.17E-8417468IPR009057Homeodomain-like
PROSITE profilePS512939.988417468IPR017884SANT domain
SMARTSM007179.1E-5418466IPR001005SANT/Myb domain
PfamPF002491.5E-5420461IPR001005SANT/Myb domain
CDDcd001672.21E-4421460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 908 aa     Download sequence    Send to blast
XEDVGNDDAL GFVTSCGDHS SSTVSDGEDV DNGREDDKLY HFIFATNKVI ANETSDELNR  60
ILLPTTHLCN KISKSTDESL NKTKIASRKR FLKLKERVIT SKFRVLQHAW KEDLQLLSVK  120
KTGGKSQKKF ESSSRMGYAD HQKYSSSIHS RLYPPGGSVS LVPTTETLDY VKKLLSDSRV  180
KVHRKTLKMP CLILDRSERM MTRFVSDNGL VEDPVEVEKE RSIVSAWTEE EQGIFLEKYS  240
LFGKDFKKIA SFLKNRTCGD CVEFYYKNHK SDCFQKIKKK SAFAKGMSCI TNTYLVTSGR  300
RMAADATSLE MLGAASEMVA SVDGEQKLDS GMFCNEQETA AADVLAGICR SVSSEALGSC  360
ITSSVDNGDV QHHEHGRRRS RCQMVGGGSC SKRRQHLTQK EDVDDESCSD ESCGEEVDTS  420
TWSDAEKIKF IKAFRSCGKN FANISICVKT KTIDQCRVFF SKARKCLGLD VIDVEQADNN  480
QEEEEEEEEE EGEDALMVDS GSDISQDNKS SLECSKMDNL VGSNGENTYS GEQSCASDDA  540
KVASSEIFIQ EGIREEDEEP MAMATTETDG CLDLNCNNMK LSCSDGNNGL LVSNLFPGNP  600
TANCAIPFKK TIRIRQEEDE SASSSRLSFR KSCEEDKKYE SKDGFHLNLV PKHSLMDCAA  660
DESSQVFRGY PVNSGMIGYS EATQSQSQSK LKLGESLLME ARGPQDVEKP SRTGHGNVKL  720
FGQIITNQPP PQAQAQAQEN GCGGKVKSFG LKFDDDDDRR KVDVDVDVDT LLRRSDNGYW  780
GDGNNNNRIR IPDSARLLAK YPAAFSKTSS FHPFTKFDQH QHSSSSSLNK IISAGFPSCS  840
KNGGGRQEGV VDKLLLPNVN VVGGISDAVA AIRMHYAYAA NKTESLQHLY DYNNKVEDEA  900
AAWRRRMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D5e-14184275494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C5e-14184275494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368896.11e-126PREDICTED: uncharacterized protein LOC103432458 isoform X3
RefseqXP_010658422.11e-126PREDICTED: uncharacterized protein LOC100240985 isoform X1
TrEMBLA0A103YIK90.0A0A103YIK9_CYNCS; Homeodomain-like protein
STRINGVIT_13s0019g04010.t011e-126(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-67MYB family protein